SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801218|ref|YP_326226.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801218|ref|YP_326226.1|
Domain Number 1 Region: 68-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000857
Family TRAM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801218|ref|YP_326226.1|
Sequence length 130
Comment hypothetical protein NP1132A [Natronomonas pharaonis DSM 2160]
Sequence
MEISEKLLCLFSAEVEETEDKYVVEVPRREVDTGAIEAGDTYRVALISGAEAAQTETGGA
SAAPSDEPQPPVEEGEIRYVEIEDLGKQGDGIARVERGYVIIVPDAEVGERVKIEVSEVK
SNFAVGEIIE
Download sequence
Identical sequences A0A1U7EUM4
WP_011322293.1.57290 348780.NP1132A gi|76801218|ref|YP_326226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]