SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801248|ref|YP_326256.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801248|ref|YP_326256.1|
Domain Number 1 Region: 11-144,179-399
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.66e-86
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000984
Further Details:      
 
Domain Number 2 Region: 401-613
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 7.29e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00026
Further Details:      
 
Domain Number 3 Region: 594-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-24
Family Myf domain 0.00053
Further Details:      
 
Domain Number 4 Region: 140-163
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000824
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801248|ref|YP_326256.1|
Sequence length 698
Comment methionyl-tRNA synthetase [Natronomonas pharaonis DSM 2160]
Sequence
MHEEFPTETPAVVTCGLPYANGDLHVGHLRTYVSGDAYARALESLGQSVAFVSGSDMHGT
PIAVNAAEEGVDPESFAVEYHEQYEETFPQFNIEFDNYGHTHDETNTEMTRSFVRSWIDD
DHVVEKEIEVAWDAEADQPLPDRFVEGTCPYCGEKARGDECDEGCQRHLEPGEIEAPVST
ITGNPAEYRTRPHKFLRLSDFQEYLRGFIDRLEGTENAQNQPREWIEGELQDLCITRDMD
WGIDYPADGDESGEDLVLYVWVDAPIEYVSSTKQYSEQVGRDEYDWEAVWKNQVDGVPPE
GGEIVHIIGHDIIQHHTVFWPAMLRGAGFNEPRAVMACGFVNLDGDAFSTSRNRAVWADD
YIESGLHPDLYRYHIITGSEFTADVDFSWDGLQERTNSELVGTLGNFLYRSLLFAERNYG
GTPDAAVSDEVRNEIEAAMADFRTAVNDYRVRGLGRAPVELATFGNEYIQRHEPWKLTDD
DPEKARQVIRDCVQIAKAIAVLAEPVLPGKAAALWDQLGEDGSVHDAELGAALESPPEAF
DEPDELFEKLEDDRIEELNRQLEERIEAADAGDEEGEDEDEEPPAADLEPVADERISFGD
FQDLDIRVAEVLEAEPIEGADDLAKLAVDIGVETRQIVAGIKQLHDLDSLSGTRIVVVAN
LEKAELFGVESNGMLLAAGEQADLLTTLEDAEPGTKVQ
Download sequence
Identical sequences Q3IT47
gi|76801248|ref|YP_326256.1| 348780.NP1192A WP_011322323.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]