SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801281|ref|YP_326289.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801281|ref|YP_326289.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-33
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801281|ref|YP_326289.1|
Sequence length 97
Comment translation initiation factor IF-1A [Natronomonas pharaonis DSM 2160]
Sequence
MSDNEGRKNLRMPEGDEVFAVVTNMLGANRVKVRCMDGTERTARIPGRMQKRIWIREDDV
VLVEPWDWQDEKADVVWRYEKQEADQLREEGHITDSV
Download sequence
Identical sequences Q3IT14
WP_011322356.1.57290 gi|76801281|ref|YP_326289.1| 348780.NP1258A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]