SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801459|ref|YP_326467.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801459|ref|YP_326467.1|
Domain Number 1 Region: 172-257
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.96e-22
Family eIF-2-alpha, C-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 6.08e-21
Family eIF2alpha middle domain-like 0.0053
Further Details:      
 
Domain Number 3 Region: 5-81
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5e-18
Family Cold shock DNA-binding domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801459|ref|YP_326467.1|
Sequence length 266
Comment translation initiation factor IF-2 subunit alpha [Natronomonas pharaonis DSM 2160]
Sequence
MKYSGWPTPGELVVGRVDEIEDFGVFVDLEEYEEKRGLVHVSEVASGWIKNVRDHVNEDQ
MVVCKVLEVDESAQQVDLSIKDVNDHQRSEKVQEWKNEQKADKWMELAFGEDVDDGTFRR
IANELIDAHGSLYAGFEQAAIHGPEALDATDLDDDELDAIVETARENVSVPYVTVTGYVD
LEAPGGDGVEDVREALQAAEGNGEVPEEVDLDVTYVGAPEYRIRVQAPNYKTAESELEAS
AERASDAIEAVGGTAEFHRERRTDEE
Download sequence
Identical sequences A0A1U7EV87
WP_011322534.1.57290 348780.NP1618A gi|76801459|ref|YP_326467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]