SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801751|ref|YP_326759.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801751|ref|YP_326759.1|
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-24
Family SSO2064-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801751|ref|YP_326759.1|
Sequence length 121
Comment hypothetical protein NP2216A [Natronomonas pharaonis DSM 2160]
Sequence
MSDLTHNEWVSAVKDGELLGQTCPDCGATHGTPKAACPHCGSRDLETVALPTEGTVYTET
TINVPPINIDERGYQVAVVAVGEARVMGRLVEEDVDIGDSVAVAGYDEDDTGNVTPRFEA
V
Download sequence
Identical sequences A0A1U7EVV6
WP_011322826.1.57290 gi|76801751|ref|YP_326759.1| 348780.NP2216A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]