SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76801946|ref|YP_326954.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801946|ref|YP_326954.1|
Domain Number 1 Region: 2-160
Classification Level Classification E-value
Superfamily Thiolase-like 1.64e-22
Family Chalcone synthase-like 0.0031
Further Details:      
 
Domain Number 2 Region: 346-457
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000011
Family SSO2064-like 0.021
Further Details:      
 
Domain Number 3 Region: 213-323
Classification Level Classification E-value
Superfamily Thiolase-like 0.0000000487
Family Chalcone synthase-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801946|ref|YP_326954.1|
Sequence length 476
Comment hydroxymethylglutaryl-CoA synthase 1 [Natronomonas pharaonis DSM 2160]
Sequence
MTGIAGVGAYAPRFRITAAAFEDAWGRFEAAGVEEKAVPAADEDALTMGYEAATRALDAA
AVDATDIDWLGVASSRPPIAEEDVSARLGAMLGLSDAATRHVFTGSTRAGTRALWACLDA
VDAGTATGLVVAADCPAGTPDDGIDHAAGAGAAAFVVGPDGGARIVDRAEYAAPYPGTRF
RRTGEAETRGLGITEYDRQAFTEAVGAAADRLDAIDDPAAAAIQAPDGKLPYRAAGAAGV
DAETIQAASTVHELGDLGAASVPVSLAKGLADGRESLLAVSYGSGAGADAFAVAADGDVP
TRMALDGDASLSYAEYLRQRGVVTAGPPSGGGAYVSVPSWRRSLPQRYRLVAGRCAECGA
LSFPPEGACDDCNGLVAYDPVELSGEGTIEAVTTISQGGAPPEFAEQQDRAGDYAAAVVA
LDAPSGARSVSVPAMGTDAAPADFDVGDRVETTVRRIYTQEGVTRYGFKVRPMADK
Download sequence
Identical sequences A0A1U7EWC6
WP_011323020.1.57290 348780.NP2608A gi|76801946|ref|YP_326954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]