SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802113|ref|YP_327121.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802113|ref|YP_327121.1|
Domain Number 1 Region: 510-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.5e-58
Family Tandem AAA-ATPase domain 0.024
Further Details:      
 
Domain Number 2 Region: 2-101
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000188
Family Single strand DNA-binding domain, SSB 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802113|ref|YP_327121.1|
Sequence length 883
Comment helicase [Natronomonas pharaonis DSM 2160]
Sequence
MNVRGPVLEVDDPKSVETSHGTSQLAEVVIRPERGAASPTTVTLWGKWTETVEYLAVGME
LLATDLDERTFDGDTQYSTTGESAVVVEPDFLVDVTDIRGWVQCPRMYYLNKLTGLPLKY
PVLKGTVVHEVFGDLLRGRDLESSIESRVAEAALDIGLLGETADAVADDVRQNAAAIQGW
LQQGRFGEDSWRSEQTLISERFGIKGRADAVRRGMPVELKTGKNLKRSPRFQDKVQAACY
GLLLADDIADPPDTGTLLYTKNSALDRSEESGDLSPAKEFSIGPGFLKYVLRVRNEIAAA
EYDMSVPTGFEADANCDYCFEQDTCMVVSGRLDQESKAGQLGEPLPEPERAYFERLYRAI
EEERREVHAEYRKLWEQSAAERADDDRALVDLDPLGREPLDGGRWALSARRTSDAVSKIR
EGDRVLASDGHPTQGTAELATVRHLDDEIVVVADEPFELRRIDVYPSELGVDRQLTALHD
AVLRGDPDRKDVLFGRREPSFVGDHRPIIDNNESQNEAVNRALAAEDFALIHGPPGTGKT
YTLAQTVQALVARGDRVLLSAFTNRAVDNAIEALEAQGFTDVLRWGSESGVRDDMQSYRF
DRTGDPRERAAALRDAQVVAATTAACGSRALKQQQFDVAVIDEAGQLTEPGTFLATNRAD
RFVLVGDHEQLPPVVRAENDLQTSLFEQLIDDYPDAAVMLDRQYRMSQRIQYFASREFYD
GQLRPANAEVASQRLADLDGVDVSTLPSALRDAVSFVDPGGSADGNTNPTEADRVADIVS
AYLDAGVDPDDIGVIAPFRAQVAELSRRIDEVTVDTVDRFQGSSKEVIIVSFVATGELSS
PIFEDYRRVNVALTRAKKALVLVGDATALRSVPFYERMLEWAG
Download sequence
Identical sequences A0A1U7EWT9
NpR14 WP_011323187.1.57290 348780.NP2944A gi|76802113|ref|YP_327121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]