SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802467|ref|YP_327475.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802467|ref|YP_327475.1|
Domain Number 1 Region: 11-73
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-23
Family Cold shock DNA-binding domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802467|ref|YP_327475.1|
Sequence length 75
Comment 30S ribosomal protein S28e [Natronomonas pharaonis DSM 2160]
Sequence
MSAEEQEEGGATPAEVIEVVGETGMHGEAMQVKCRIQEGENQGRIIARNVLGPVRVGDVI
QLRETAREADSIGGQ
Download sequence
Identical sequences Q3IPM8
348780.NP3662A gi|76802467|ref|YP_327475.1| WP_011323540.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]