SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802567|ref|YP_327575.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802567|ref|YP_327575.1|
Domain Number 1 Region: 250-399,592-929
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.29e-83
Family Tandem AAA-ATPase domain 0.00061
Further Details:      
 
Domain Number 2 Region: 935-1020
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000188
Family Single strand DNA-binding domain, SSB 0.012
Further Details:      
 
Weak hits

Sequence:  gi|76802567|ref|YP_327575.1|
Domain Number - Region: 90-200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0964
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802567|ref|YP_327575.1|
Sequence length 1028
Comment helicase [Natronomonas pharaonis DSM 2160]
Sequence
MTWEELQHELKRDERRWGRRFLPQAVHIRLFGDPEQQRRRYEVAREQVKTRYDELHSTID
DNLQRLHTDLSPAIEDGQSIDASPKYEKTLQHLRDDLDSFHVDLDEQLSVDRPPEAFLRS
EEQQTLEDWKRQHDQLESFLKAKVEFDDRMPAMERTVERLYERTECYRSYDQYLTRPEQT
EINERCRQIRDQLDRLRNELNLDLLADTDRHRLSDVETTLDAIIEHLQDYNNEFVDRRCA
EYDDLFSDIDEEGNDLNRAQREAVVTNDLRNLVVAAAGTGKTLALTYRVAYLVAEGVDPA
RIAALTYTRQAAREMELRLEEQFGIEQADVRTIHSFAYEIAQETADGYLDVADSQDLYNL
IDEVIREARNGQRERFFEHYTQFLFHYDHTHLEEADFDSRTNYVAKRSEESYETLAGETV
ASRAERVIADFLFTHDVTYQYEAVATWADSADDKGEYRPDFYLPEYDLYIEHWGLDRNGE
VSPWFSWSTDQYHEKLFWAREEFVNNDRSLIETYEFEYEAGRLKAALQHRLEHAGVELRR
LDFEEFVNQAFEYNKKERDIKESLASFVHNAKTFRIDADDARSRLTPTNARKYHFGHCGA
FVLEAYNAYLDRAGLVDFDDMINEAIAAIQADPESYWAQFDHLLVDEFQDVSRHQLELIR
AFTGGEDLQETPRLFCVGDDWQSIYSFQGADVDQFIAFEENFGPTAETRLTENYRNPVTV
LEAGNDLIANNDHQIAKTVRAAAGHDCQPTLHVLDGYTENAYERRVGEYAANLVEQRLEK
GIGTEPSDAMVLCRYDAGAPFTDRVKAELERRNIPYDGKDDHYRPEDMPDEYDPDFDPDA
GVAVYSVHQAKGREAEQLIVLNVVSGMYGFPADHRENSLVAPVQDLETATVEEERRLFYV
ALTRAESEMHVLTRGEQWSLFIEEIKPYLTLNQSVASLSPSDEEESITAKVQLLWDDLHE
TQHQAGVLEDQSGTIRFVSWATESPPTVKEEVWYRFESIEINEFNGDTQVQLGTETTAME
LYRADQSR
Download sequence
Identical sequences A0A1U7EXV8
gi|76802567|ref|YP_327575.1| WP_011323640.1.57290 348780.NP3864A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]