SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802581|ref|YP_327589.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802581|ref|YP_327589.1|
Domain Number 1 Region: 4-68,105-191
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000001
Family Lambda integrase-like, catalytic core 0.03
Further Details:      
 
Weak hits

Sequence:  gi|76802581|ref|YP_327589.1|
Domain Number - Region: 216-268
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00457
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802581|ref|YP_327589.1|
Sequence length 300
Comment hypothetical protein NP3892A [Natronomonas pharaonis DSM 2160]
Sequence
MNGDPLTREQTAAFRQAADQGDFVDRLLMVLLHTGLTATEFTHMHDNWLEPLPESVEAYQ
GDTPIIRIPTEADCRGIKLGTNLEIHQRTGRCGYCNDLGYEVWHPGQPDSDCRVRSIPIP
DETTARTLYWWFARYDSTPISVNSLERRLSKLADRADIGRDVTSRDVRATYGTNLVRMGF
SSEEIAKLMGLFHHISTREFFEAADEPVDWPEVVSDATILAAIAENEPVIKSDVGDLVGF
SVTAGRKRANDLIDRGILKKVGERHEGHVHGTTYGIDPSVLKDEGYHEIAERYYKARLEQ
Download sequence
Identical sequences A0A1U7EXW2
348780.NP3892A WP_011323654.1.57290 gi|76802581|ref|YP_327589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]