SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76802614|ref|YP_327622.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802614|ref|YP_327622.1|
Domain Number 1 Region: 168-278
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-22
Family Single strand DNA-binding domain, SSB 0.0043
Further Details:      
 
Domain Number 2 Region: 59-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9e-22
Family Single strand DNA-binding domain, SSB 0.0054
Further Details:      
 
Domain Number 3 Region: 283-399
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000113
Family Single strand DNA-binding domain, SSB 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802614|ref|YP_327622.1|
Sequence length 425
Comment replication factor A [Natronomonas pharaonis DSM 2160]
Sequence
MSLDDAAEDLASSLGVDKAEVKEDLEKLVSYSVPMDEAKQSLRRKYGDEGSTGGGADDAP
TTDIEEITTDDDRVTVTARVLTVGKRSIRYDGDDQTIFEGELADGTGRISYTAWTDFSLT
PGDTVTVGNAGVREWDGNPELNLGQSTTVTLEEEPLSVPYDVGGQRNLIDLEPGDRGRTV
EVRVLEVEQKTIDGRDGETEILDGVFGDETSRLPFTDWDPHDAIEAGTSVRLEDVYVDEF
RGVPSVNVTAFTTVEAIPEVAVSDEATAMSVQEAVDAGGVYDVELTGNIIEVRDGSGLIQ
RCPECGRVVQNDQCRSHGKVDPEDDLRVKAILDDGTDSVTVILGRELTEEVYGGTLTDAL
EAARDEMDRGVVADDIAETLAGREYRVRGSLSVDEYGANLDATDFEESGGDPASRAERFL
AEVGR
Download sequence
Identical sequences A0A1U7EXY5
gi|76802614|ref|YP_327622.1| WP_011323687.1.57290 348780.NP3960A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]