SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803060|ref|YP_331155.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803060|ref|YP_331155.1|
Domain Number 1 Region: 92-236
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.26e-51
Family C-terminal domain of ribosomal protein L2 0.000000164
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-23
Family Cold shock DNA-binding domain-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803060|ref|YP_331155.1|
Sequence length 243
Comment 50S ribosomal protein L2P [Natronomonas pharaonis DSM 2160]
Sequence
MGRRILGQRRGRGTSTFRAPSHRYKADLSHRNVEESDLVTGEVVDIEHDPARSAPLADVQ
FDDGDRRLVLAPEGVTVGDEIQIGVSAEIAPGNTMPLAEIPEGVPVCNVERQPGDGGKFA
RASGVSATLLTHDRNAAVVQLPSGEMRRLSPECRATIGVVAGGGRTEKPFVKAGNKHHKM
KSRGGKWPRVRGVAMNAVDHPFGGGGRQHPGKPKSVSRDTPPGRKVGDIASKRTGRGGKG
GQE
Download sequence
Identical sequences Q3IMY5
WP_011324133.1.57290 348780.NP4860A gi|76803060|ref|YP_331155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]