SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803168|ref|YP_331263.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803168|ref|YP_331263.1|
Domain Number 1 Region: 80-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.54e-23
Family Cold shock DNA-binding domain-like 0.0000871
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.35e-17
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803168|ref|YP_331263.1|
Sequence length 189
Comment DNA-directed RNA polymerase subunit E' [Natronomonas pharaonis DSM 2160]
Sequence
MYKRVRLKDTVEVPPRHLADVSPELVKRLLQDKLEGQMDEDVGSIVSVTAVHDIGDGAVL
PNRPGVYYEAEFDAVTFDPQMQEVVDGEVVEVVNFGAFVGIGPVDGLLHVSQISDEYLAY
DEENQQLASRDSNRVLSVGDSVRARIVTKSIDERNPRDSKIGLTAKQPGLGKHGWLEEER
QRREAQAGD
Download sequence
Identical sequences A0A1U7EZC2
348780.NP5080A WP_011324241.1.57290 gi|76803168|ref|YP_331263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]