SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803461|ref|YP_327730.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803461|ref|YP_327730.1|
Domain Number 1 Region: 77-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-39
Family Extended AAA-ATPase domain 0.0069
Further Details:      
 
Domain Number 2 Region: 363-470
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000517
Family Helicase DNA-binding domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803461|ref|YP_327730.1|
Sequence length 489
Comment cell division control protein cdc6-like protein [Natronomonas pharaonis DSM 2160]
Sequence
MGTDDSDASRPESRTPEDETTQADLSSSATSSNVPADVDHSTEAADGSPDAGSRSDESSS
QSIEDMLLEFDEQDGLIRDRSLLDPNYVVDEDRIVGRDDQLQEVTKMLRVTLGDNRPPNL
FLYGPSGTGKSLITKAVCNNINRICETRDIDFGTIEVNCQDLDTLGVAVYELATQAAEQA
GVAVQVPKHGVATKEKWDELFRIVNENFDSVVFVLDELDMLVGRRDKQEPAFSRLLYQLS
RAEATNDLRAYLSVVAISNDTKMMESVGSRALSSFTPEDVHFDDYDANQLQTILRHRQDA
FHDGVVDDDVIPLAAAFAAQTHGDARKAIDLMRVAGELAEREGSTRVREEHVRQAQEKVE
KNRVLEVVRGISTQKKLCLYATAAVAAQTDGGTARSTTGYRVYQFLTDSINADQYHQETY
VNKMKELTTYSLVDFERRSHGPSSGMFLEFQFGERPETILETLREDSRIEMVTSEEVQSV
VQAQIRKQT
Download sequence
Identical sequences Q3ILY5
gi|76803461|ref|YP_327730.1| 348780.NP6208A gi|76803461|ref|YP_327730.1|NC_007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]