SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803470|ref|YP_327739.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803470|ref|YP_327739.1|
Domain Number 1 Region: 74-136
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000028
Family TRAM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803470|ref|YP_327739.1|
Sequence length 139
Comment hypothetical protein NP6228A [Natronomonas pharaonis DSM 2160]
Sequence
MTEIPDPLRTLYSASIEKQDGTYTIEVPLQEIEHGAVEPGETYRIAILESTETDTSSQQP
SRPAPAPTADADEPTGPPVDEGEIREVTVETVGDQGDGIAKVERGYVIIVPDAAPGDEPT
VEIQQVRENVAFADVVGHE
Download sequence
Identical sequences Q3ILX6
gi|76803470|ref|YP_327739.1| WP_011324491.1.57290 gi|76803470|ref|YP_327739.1|NC_007427 348780.NP6228A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]