SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_1_22730|chrm1_SC6|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_22730|chrm1_SC6|Putative
Domain Number 1 Region: 263-363
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-30
Family PDI-like 0.027
Further Details:      
 
Domain Number 2 Region: 41-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.56e-21
Family PDI-like 0.036
Further Details:      
 
Domain Number 3 Region: 369-481
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000067
Family PDI-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pa_1_22730|chrm1_SC6|Putative
Sequence length 722
Comment protein of unknown function
Sequence
MRLRNLFVFGAAALATASPPSADTEEDITRENTYFNGKKVPPILELTPANYKEELKKSKF
LMVKHFSPWCGHCQEFLPTFQTLYEYYYTSKPVGKDADFTEFYDFRFAELNCVAYADLCT
ENKVAAWPTTILFEDGEPLVTFRGVKHISVLSGAVEDALEKVKPNTRPKTLELPEPGDKT
SPDSKAETEKTEKADAREKGSEKELVKETEKEKETETSTAASADASTEGEATPKKTYTVN
YNTPSQKVTPKPSNPNPKGLSVPLTWELFQSMVTLTQEPWFVKFYAPWCHHCQAMAPNWE
QLAKEMKGRLNIGEVNCDRDTRLCKELRVRGYPSIMFFKGGEKVEYEGLRGLGDFVQYAE
KAIDLSSGVPDVDFDSFKALEEKEEVIFLYFYDHATTSEDFLSLERYPLSLIGKAKLVKT
RDPKLYDRYKITTWPRLIVSREGRPTYYTPLAPREMRDTRMVLNWMKSVWLPLVPELTPS
NARDIMDGKIVVLGVLNRENEDSFRGAIREMKSAANEWMDKQIQLFQIHRQDLRDAKQLR
IEEAEDRGDQRALRNAKNIRINMDRSDMKEATFAWVDGNFWQRWIRTTYGIDAKDGDRVI
INDEDKRRYWDQTSTGNPIVPSRTSILETLNKVTVNPPKLKPKLTIGVIEKMFFDIKMTF
KEHPYLSMGCILGIAFGLFQWLMGRTTRRARSHFKLEEGVGMKESKPSTLFGGSSNTATK
AD
Download sequence
Identical sequences B2AS91
XP_001906593.1.27508 Pa_1_22730|chrm1_SC6|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]