SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163685|ref|YP_342210.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163685|ref|YP_342210.1|
Domain Number 1 Region: 125-241
Classification Level Classification E-value
Superfamily TPR-like 5.36e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Weak hits

Sequence:  gi|77163685|ref|YP_342210.1|
Domain Number - Region: 33-110
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0146
Family Seryl-tRNA synthetase (SerRS) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77163685|ref|YP_342210.1|
Sequence length 257
Comment TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
Sequence
MMVSWCRGRWLLAGGVLWAQLSVASGAEEVEVIDPGALEQRLQQIERIIEGQGLSELLSQ
MAELEANVRRLQGESEELRYEMDNLKRQQRELYVDLDRRLQKLSTSGESLSPLLPSEATE
EVAEEVLVDSGEQTYQAALELLKEGRYEEAIAAFDQFPQQYPDSRYRPNAQYWLGEARYM
LGDFNAAADTFQALVEQYPESAKVPDAMLKQGLAYYELAQWEQAKAQFQAVMTRYPASTA
SRLAEERFEKMKREGHP
Download sequence
Identical sequences A0A0E2Z6F9 Q3JER6
WP_002813219.1.20919 WP_002813219.1.77844 WP_002813219.1.91979 gi|77163685|ref|YP_342210.1| 323261.Noc_0147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]