SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163704|ref|YP_342229.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163704|ref|YP_342229.1|
Domain Number 1 Region: 253-374
Classification Level Classification E-value
Superfamily TPR-like 1.14e-28
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 2 Region: 169-290
Classification Level Classification E-value
Superfamily TPR-like 2.81e-28
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 
Domain Number 3 Region: 86-206
Classification Level Classification E-value
Superfamily TPR-like 4.09e-28
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 
Domain Number 4 Region: 8-122
Classification Level Classification E-value
Superfamily TPR-like 3.48e-20
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77163704|ref|YP_342229.1|
Sequence length 454
Comment hypothetical protein Noc_0166 [Nitrosococcus oceani ATCC 19707]
Sequence
MKLQGRLDVLQKKAKAALAIRHYKEAESLLQELLETQVQHFGDADTQIATTLNNLAALYE
AQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYAQAEELYHRSLAI
REQLLGPDHPEVATTLNNLAALYEAQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNN
LAALYKKQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYAQAEELY
HRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYAQAEELYHRSLAIREQLLGPDHPEV
ATTLNNLAALYKKQGRYAQAEELYHRSLAIREQLLGPDHPEVATTLNNLAALYEAQGRYA
QAEELYHRSLAIREQLLGPDHPEVAIMLNNLAGLYRATGLGEKAESLYDRSLAVMEKIFG
PRHPNTAIVRANRDAYKHTAPNKANSADAKKRRG
Download sequence
Identical sequences Q3JEP7
323261.Noc_0166 WP_011330246.1.91979 gi|77163704|ref|YP_342229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]