SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163723|ref|YP_342248.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163723|ref|YP_342248.1|
Domain Number 1 Region: 39-210
Classification Level Classification E-value
Superfamily TPR-like 1.52e-16
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 2 Region: 203-324
Classification Level Classification E-value
Superfamily TPR-like 0.000000000179
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77163723|ref|YP_342248.1|
Sequence length 387
Comment tetratricopeptide repeat protein [Nitrosococcus oceani ATCC 19707]
Sequence
MIEWLLLLLPVAAASGWLAGKRSAETVNADSHSQLNSAYFAGLNHLLNEQPDKAIDTLLN
ALKVDSDTVEPYLALGNLFRRRGEVDRAIRVHQNLIERPYLSSSQRGQALLELGLDYMRA
GMLDRAESSFLEVLKRRSHIGITLRQLLDLYQQEKNWHQAIAMAQKLHEESGEATESMIA
HFYCELAEQHWAQKKAVETTRFIKQALASDWRCVRATLLQSSLAMEKGDYKRAIRCLRQV
ERQDPDYLPEILKPLSECYQYLEGQDKFFFWLTEASKRHPGCTSLVLARAAYLQQRGEQK
EARYFLIEQLRVYPSVEALQQLLALGVPEDIEAASEPWSLIEEVASRLLKAKLNYVCGFC
GFGGKYCYWQCPGCKRWGTVKPLAVGT
Download sequence
Identical sequences A0A0E2Z606 Q3JEM8
323261.Noc_0185 WP_002814025.1.20919 WP_002814025.1.60716 WP_002814025.1.77844 WP_002814025.1.91979 gi|77163723|ref|YP_342248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]