SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163745|ref|YP_342270.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163745|ref|YP_342270.1|
Domain Number 1 Region: 260-379
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000006
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 2 Region: 110-246
Classification Level Classification E-value
Superfamily TPR-like 0.00000000294
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Domain Number 3 Region: 30-145
Classification Level Classification E-value
Superfamily TPR-like 0.000000218
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77163745|ref|YP_342270.1|
Sequence length 476
Comment hypothetical protein Noc_0210 [Nitrosococcus oceani ATCC 19707]
Sequence
MHRLCQKNFGGAGELLREAAEGKAKQLAKVRKELEQLTEETVNSFRLAGDAHSNNYAFDE
ALIAYEQALACVLREITPHLWAVIMVQVGRACHELGVRAEGAALHYHLSAAVEAYRRALK
VQTRRYLPQDWARTQAYLGTTLREQGVRMGEEAGGRLLEQSVEAYRRALKVQTRWHLPQD
WARTQAHLGTTLREQGVRMGGEAGGRLLEQSVEAYRQALEVQTRRDFPQDWAWTQSHLGI
ALREQGMQAGGEAGRQLLGKAIAAYQGALEIHTPETLPWHWNQTQHHLIQTWLALEDWPA
AATGFVRLLEIYPDDAEAYYGASMLYHEKLFAFEEAFSLSRRWFASRPEDLEARGQLAEQ
CFTTGRFAEAIEHFAELLANPEINPQIKIPLQAFEIAALLGLNQKVAVPEKFEQLCMAIA
HQSGNFVLEWAFAGSKYFIARNERLMPYREWLLALFIALEAPGRDAILNRLGEDIR
Download sequence
Identical sequences Q3JEK6
gi|77163745|ref|YP_342270.1| 323261.Noc_0210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]