SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163751|ref|YP_342276.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163751|ref|YP_342276.1|
Domain Number 1 Region: 21-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000897
Family Thioltransferase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77163751|ref|YP_342276.1|
Sequence length 96
Comment glutaredoxin [Nitrosococcus oceani ATCC 19707]
Sequence
MAANPASVNYPMTITTHSKRLILYHTAGCHLCEEARQLLAQLPEITTEEVDIGNDPLLVE
RYGTRIPVLLQPDSGLTLNWPFTLEAIHQWTHAGQR
Download sequence
Identical sequences Q3JEK0
gi|77163751|ref|YP_342276.1| 323261.Noc_0216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]