SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163830|ref|YP_342355.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163830|ref|YP_342355.1|
Domain Number 1 Region: 82-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0099
Further Details:      
 
Domain Number 2 Region: 13-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77163830|ref|YP_342355.1|
Sequence length 214
Comment glutathione S-transferase-like protein [Nitrosococcus oceani ATCC 19707]
Sequence
MPLSPGKRSVTALFSDPLCPFCHRTRIVVAEKNISAEIIDIDPANLPEDLVRLNPHNSAP
TLVARDLILYDSKVIMEYFDERFPHPPLMPVDPISRARIRLMFYRIDQDWYRLLGGTKTH
RSNISSKTRKMLIEDLTILSPTFEKTPFFMNEEFSLLDCALAPLLWRLLALEAELPPQAK
LVEDYANRMFARDSFQQSLSAAERAMRTKATSPI
Download sequence
Identical sequences A0A0E2Z504 Q3JEC1
WP_011330293.1.20919 WP_011330293.1.77844 WP_011330293.1.91979 323261.Noc_0296 gi|77163830|ref|YP_342355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]