SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163887|ref|YP_342412.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163887|ref|YP_342412.1|
Domain Number 1 Region: 278-627
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-78
Family L-arabinose binding protein-like 0.0000331
Further Details:      
 
Weak hits

Sequence:  gi|77163887|ref|YP_342412.1|
Domain Number - Region: 50-156
Classification Level Classification E-value
Superfamily TPR-like 0.0266
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77163887|ref|YP_342412.1|
Sequence length 629
Comment LppC lipoprotein [Nitrosococcus oceani ATCC 19707]
Sequence
MYPLIPMVIFFRKAGNYLPLAGLAILLGLTACTSPSPKVSPQAPSSELVQAKALAAEGRY
RAAATAYTQLAADAQSPQRQDYQLHAAAALLQGNYQQEAKMLLESIAPESLESPLKLRYH
LLAAQLAIAEGEMKRALLLLEGVESLGPSLEQQAALHRLRAQAYELEDNPLAAARERVQL
EPLLSDAQALQENQRALWGLLMGLSPYTFGSLPQEPLSPALQGWLELARLFQRYQLDSPD
LQQAIENWQARYPGHSASLPLLQAEMATLPTTAYQPSIALLLPTEGQFAASAKAVQNGFF
AAYYNDNNGWPSNIRFYEVKIDSETGNSNIYSIYQQAQTEGAYFVAGPLTKQSLAQLVAT
GDLSLPTLALNYLEKSHEGIEKLYQFTLSPEDEAREVAERAWHDGHRNALALIPNTQWGQ
RVKDAFAERWERLGGTLVKSQAYDPEKEDYSPLIQRLLDLDDSQSRQRALQELAFEPERR
HEADFIFLAAFPRQARLLVPQLRFHRAEKLPVYSSSHIYTGYPDPENDQDLNGVLFCDIP
WVLDKNAQNDPSYQSLAAAYPRNLEQLKRFYALGVDAYRIIPHLKALQQNQDMTFDGATG
TLQMDAGRHLRRTLNWAQFKKGQPQPVAK
Download sequence
Identical sequences A0A0E2ZAD7 Q3JE64
323261.Noc_0356 WP_002813921.1.20919 WP_002813921.1.77844 WP_002813921.1.91979 gi|77163887|ref|YP_342412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]