SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77163912|ref|YP_342437.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77163912|ref|YP_342437.1|
Domain Number 1 Region: 21-245
Classification Level Classification E-value
Superfamily TPR-like 2.28e-23
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77163912|ref|YP_342437.1|
Sequence length 422
Comment hypothetical protein Noc_0381 [Nitrosococcus oceani ATCC 19707]
Sequence
MPSEAVPLQLTRIQALEDVLRQLKDEKPELVASLQGELGNALATSSMGSSRAYNLEQAIQ
AYQAALEIRTRNDFPEQWATTQHNLGNAYGKRIRGVGAENLEKAIQAYQAALEIRTRNDF
PEQWAMTQHNLGNAYGKRIRGAQAENLERALEAYEAALTIYTRDAFPEDWAMTQHSLGNA
YRDRIRSAGAENLERALEAYGEAARIYTTDTNPEAARQVRLGQSAALLKAGRWQAALDAS
EEGLAASRILFDISLHDPEVREREIGTSEMLYAHCAFAQAQLGRPDKALAILEEGRAREL
RYRAGRDRADLEDLPEQRRAAFLQAAQRVRDLEAEWRRPEEERPADLADKTRQARQGLEQ
EAQQIRVLKPNFLRASVDLHDIRAVLPGQDAALVEFAVTEAGTLALVLPAGQGALKRSGW
RA
Download sequence
Identical sequences A0A0E2ZAE8 Q3JE39
WP_011330317.1.20919 WP_011330317.1.60716 WP_011330317.1.77844 WP_011330317.1.91979 323261.Noc_0381 gi|77163912|ref|YP_342437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]