SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164033|ref|YP_342558.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164033|ref|YP_342558.1|
Domain Number 1 Region: 153-389
Classification Level Classification E-value
Superfamily TPR-like 0.000000000538
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164033|ref|YP_342558.1|
Sequence length 427
Comment HemY-like protein [Nitrosococcus oceani ATCC 19707]
Sequence
MKAVIFGLIVLILAIGLELLTHDDSGYLVIGYGQWMIETTLTLAVIVLGLIFIGGYLALR
FVSHIGKAPRRLGESRQRRRSSRASKMLIEGLIDIEEGNWDRAERALVKDIAYSNTPLLN
YIAAARSAQNQGAYERRDHYLHLAREAVPAATFAIELIQAELQVNSGQFEEALAILNHLR
TLDPRHPQPLKLLKSLYLQQRDWDQLLGLLLQLCKRRLVSKEEAHSLEVMAHVELLQEAA
QSESNAALIDRWKAVPNRFRKHPKIVAAYVYALIDRNEHDLAEQLLQDTLKGNWSDELIY
LYGLVQSSDLVAQLTRAEAWLSQQGDNPWLLLTLGRLAQYNGLWGKARQYLETSIAYAPR
SEAYHELGKVLEEIGDSEAALECYSKGLSMATRGAVEESVKFSLPEKAREISLSGSDYTP
QLTGPAP
Download sequence
Identical sequences A0A0E2Z462 Q3JDR8
323261.Noc_0505 WP_002812117.1.20919 WP_002812117.1.77844 WP_002812117.1.91979 gi|77164033|ref|YP_342558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]