SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164060|ref|YP_342585.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164060|ref|YP_342585.1|
Domain Number 1 Region: 37-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000405
Family Thioltransferase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77164060|ref|YP_342585.1|
Sequence length 162
Comment hypothetical protein Noc_0535 [Nitrosococcus oceani ATCC 19707]
Sequence
MRLIYQLSLGLLLVLPVISSHAEESVWDKAQVSYFGPSNITVYRSPTCGCCKKWVEHLEQ
HHFTVKDITTDNMQTLKQQYGVPRELASCHTAIIDGYVIEGHVPADDIKRLLMEKSKITG
LTVPAMPVGTPGMEMGARKDPFHVLQFNEAGQSKPFNAYQNY
Download sequence
Identical sequences A0A0E2Z4V3 Q3JDP1
WP_002812708.1.20919 WP_002812708.1.60716 WP_002812708.1.77844 WP_002812708.1.91979 gi|77164060|ref|YP_342585.1| 323261.Noc_0535 2005315946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]