SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164153|ref|YP_342678.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164153|ref|YP_342678.1|
Domain Number 1 Region: 163-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000216
Family Thioltransferase 0.083
Further Details:      
 
Weak hits

Sequence:  gi|77164153|ref|YP_342678.1|
Domain Number - Region: 93-125
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 0.0144
Family Functional domain of the splicing factor Prp18 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164153|ref|YP_342678.1|
Sequence length 272
Comment hypothetical protein Noc_0629 [Nitrosococcus oceani ATCC 19707]
Sequence
MSTERRAGKPCVGFVGFCLCLTLPVYADSLQTAESQSSNTPAIEQSVTERIDSLAFRANQ
WGIDESEWQRYQSLMQGVRGSVSPATLSPLEVLGIHARSADERRRYAERWAVMMRDDAER
ILAFQRAYDDAQRRLFPNGLLIDPGVVASTKPDQGLAGKFAWQSSDRVLFFTDTQCPTCD
AVLERLLSQIKHFSGIDLYLIDVSAGDESRIRDWAASKQIDPQWVSEHKITLNIDAGALN
QVANHTGQQGQDLPILILRREGRLDPLPASRF
Download sequence
Identical sequences A0A0E2Z4K1 Q3JDE8
WP_011330411.1.20919 WP_011330411.1.77844 WP_011330411.1.91979 gi|77164153|ref|YP_342678.1| 323261.Noc_0629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]