SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164174|ref|YP_342699.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|77164174|ref|YP_342699.1|
Domain Number - Region: 91-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00644
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164174|ref|YP_342699.1|
Sequence length 134
Comment hypothetical protein Noc_0650 [Nitrosococcus oceani ATCC 19707]
Sequence
MVLTSTLSAPAIAGEAAPAIEVFTDSTFQVVSASDNTTVYVMDRINQLLQVLSEDLPSDP
ENAKQLVLARFQRMDAQLSSELENAAKGLVQAMQYGINRYPAIVINGNAVVYGVTDVSAA
TQLYQRWQTRGARQ
Download sequence
Identical sequences A0A0E2Z9N8 Q3JDC7
323261.Noc_0650 gi|77164174|ref|YP_342699.1| WP_002813132.1.20919 WP_002813132.1.77844 WP_002813132.1.91979 2005420387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]