SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164235|ref|YP_342760.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164235|ref|YP_342760.1|
Domain Number 1 Region: 34-122
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000278
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  gi|77164235|ref|YP_342760.1|
Domain Number - Region: 145-232
Classification Level Classification E-value
Superfamily TPR-like 0.0512
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77164235|ref|YP_342760.1|
Sequence length 261
Comment transmembrane protein [Nitrosococcus oceani ATCC 19707]
Sequence
MWFLKFLSLCLVLWLGGCAWLDKPPPKQPEADWTVERFYAEAKTALDAGDYQKAISFYEQ
LEARYPFGAYAQQALLESAYAYYKFNEPESALAALDRFIRLYPLNSHMDYAHYLKGLVSF
HRGVGLVEKYIPRDETQRDPESARNALKSFKTLIQRFPDSKYAEDSAQRIVYLRNRLAQH
EINVAHYYMRRGAYIGAINRAKYVVENYQRTPPVPEALTIMARGYEILGLNELKEDTLRV
LEASFPGHPGIAKARMLKAVK
Download sequence
Identical sequences A0A0E2Z4F9 Q3JD66
WP_002813129.1.20919 WP_002813129.1.77844 WP_002813129.1.91979 323261.Noc_0716 gi|77164235|ref|YP_342760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]