SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164530|ref|YP_343055.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|77164530|ref|YP_343055.1|
Domain Number - Region: 574-616
Classification Level Classification E-value
Superfamily TPR-like 0.000183
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 
Domain Number - Region: 832-868
Classification Level Classification E-value
Superfamily TPR-like 0.0257
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77164530|ref|YP_343055.1|
Sequence length 888
Comment hypothetical protein Noc_1017 [Nitrosococcus oceani ATCC 19707]
Sequence
MVRKTIVSVSVAGLLAASSSWEAYSLGIGGISLKSGLNQPFKAEIPLHAVRENSLEDIKV
KLAPSEDFFRAGLDRALVLSNLRFRPLRKETGETVIEVTSQGPIREPFLDFLVAVTWPQG
HLLREYTVLLDPPFLMEPGPAIVSSIASVQDTVAPVTPQKAETWSVQIPEPLVESTMVSS
TAKADSSAYGPIRPAETLWPIAQRVRSSSSIAPQQMMLALLRANPDVFLHGNINGLKVGR
MLTIPAEEEALKLTFAEAVEQVQQQNKAWAALGRKSQAFEAERSEEEKAPGNESGGAVNL
LAVREHVLPLLSKERGPGVQESSGEDIHLQTLLSLTQEALETRAQENEALQARLQAMELQ
VNTLQQLLSAQDARLVGLEGPEETSKKEILEGQDGKFEKVEFLAPSMEEIATLTLSSPGE
EEALPSSGEKALETALPVSSDALSATEERVPEQTKQAGEFVSAEEVSEPEGAFSAFMNLK
NLLLLSGSSILLLILAVLRLRKRKTTEKPALTIAEQEEAGKDGDDEASEVLAKEIGPIAP
LEQEVVHGMKAPASSTASQIQAESHEIMAEVDDYLAFGRHHEAATALKEALLQEPGRQDL
KFKLAEVYHAAGNGSAFVDLVEEWAPNPHGDDGLWADLVAMGKDLRPGHALFTSLRQDDA
AAQVGLELPASDFSLDFSPGDLLSDENSAVPFSPAEEEASAGENSSVETPQAEEVGLEFD
LEGMVLAKPSVQDDGITDQPVEAEREEGVIEFEPFSSPLGTEENVKEAENSEQSLEFFSP
EFEIQEDNQGLLVLETPVDDPESTPLEPADPAASVDTLGEDMSEASLPGKALLEDLDEME
VKLDLARAYMDMGDADGARGLLEEVVAEGTEQQRDTGEGLLAELAKAS
Download sequence
Identical sequences A0A0E2Z8Q8 Q3JCC1
WP_002810676.1.20919 WP_002810676.1.77844 WP_002810676.1.91979 323261.Noc_1017 gi|77164530|ref|YP_343055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]