SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164556|ref|YP_343081.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164556|ref|YP_343081.1|
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-26
Family Thioredoxin-like 2Fe-2S ferredoxin 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77164556|ref|YP_343081.1|
Sequence length 104
Comment Fe2-S2-type ferredoxin [Nitrosococcus oceani ATCC 19707]
Sequence
MSESYYRYHVFFCTNQRDDGRPCCQNHDALAIRNYAKEKVKALGLARRRQVRINTAGCLN
RCAQGPAIVVYPEGTWYTYTSRKDIDEIITEHLMNGHPVERLRI
Download sequence
Identical sequences A0A0E2Z4A2 Q3JC95
323261.Noc_1043 gi|77164556|ref|YP_343081.1| WP_002811652.1.20919 WP_002811652.1.60716 WP_002811652.1.77844 WP_002811652.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]