SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164567|ref|YP_343092.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164567|ref|YP_343092.1|
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-38
Family Glutathione peroxidase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77164567|ref|YP_343092.1|
Sequence length 173
Comment thioredoxin [Nitrosococcus oceani ATCC 19707]
Sequence
MNKIIRWPLILTVALLAGIGGYILYQTQQDDRPTTGPIRPVFKLPDAHGTEHDIREWDGK
VVVINFWATWCPPCLEEIPEFIELQRSLGEQGLQFIGVAIDRPDKVKAFIKEYGINYPIL
VSEEKAPRVAMDYGNELDVVPYTAFINRAGQIVYTHAGVLDKETTKSFILPLL
Download sequence
Identical sequences A0A0E2ZNV5 Q3JC84
WP_002809176.1.20919 WP_002809176.1.60716 WP_002809176.1.77844 WP_002809176.1.91979 323261.Noc_1054 gi|77164567|ref|YP_343092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]