SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164568|ref|YP_343093.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164568|ref|YP_343093.1|
Domain Number 1 Region: 32-154
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 7.45e-26
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00053
Further Details:      
 
Domain Number 2 Region: 499-613
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.11e-21
Family Thioltransferase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77164568|ref|YP_343093.1|
Sequence length 626
Comment cytochrome c biogenesis protein, transmembrane region [Nitrosococcus oceani ATCC 19707]
Sequence
MRIFLALALMLLGNTSATAGLLDRLGLGEAEKPPLLKVDQAFIYNAAVEDGNTIIARVNI
VEGYYLYRDKFAFQILDTPEVKVSTAKLPPGKVKEDPFFGTTEVYEGKTELQIPIKLNRQ
GTTPETVILEASLQGCSEIHGICYPPATQRISLELPSPSIDEAGSIEADSGLTPEQSPAI
ALSTQDRIVQTLFNDQIWLTLAAFFGFGLLLSFTPCVFPMIPILSGIIVGQGKNITTWRS
FMLSLAYVLAMALTYTVAGIVASLLGENLQATFQHPGILIGASLIFVLLALSMFDLYHIQ
LPSRLQTRLLRLSQKQKGGTLLGAGLMGLFSALIVGPCVAPPLAGALIYIGESGDALLGG
SALFALSMGMGTPLLFLGASAGKLLPHVGSWMQPIKYLFGVLLLAVAIWLLSRILPQAII
MLLWGALFIIGAVYLGALEALGPDTTGWSRLWKGMGLISLVYGTLLIIGAASGGGTEWQP
LRGLTVARSANTPTSTESLNFQPVKGIQGLQLALQGAGERLVMLDFYADWCVDCKRMEAT
TFSDPTVKNALRNTLLLQTDVTAYDDQDKALLNQLSLYGPPSILFFGPDGRELRQVRLIG
QASPEEFLRHLQQVNTLLAQQTSKGA
Download sequence
Identical sequences A0A0E2Z303 Q3JC83
gi|77164568|ref|YP_343093.1| WP_002809046.1.20919 WP_002809046.1.60716 WP_002809046.1.77844 WP_002809046.1.91979 323261.Noc_1055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]