SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164602|ref|YP_343127.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164602|ref|YP_343127.1|
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-27
Family Selenoprotein W-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164602|ref|YP_343127.1|
Sequence length 93
Comment SelT/selW/selH selenoprotein [Nitrosococcus oceani ATCC 19707]
Sequence
MSNKIEIQYCTKCRWLLRAAWIAQELLTTFEQEISELTLRPGTGGVFNIFANGKLVWSRK
EAGRFPEITELKQLVRNQIAPTKDLGHADKKHK
Download sequence
Identical sequences A0A0E2Z8V1 Q3JC49
gi|77164602|ref|YP_343127.1| 323261.Noc_1092 WP_002809628.1.20919 WP_002809628.1.77844 WP_002809628.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]