SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164633|ref|YP_343158.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164633|ref|YP_343158.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.38e-46
Family NQO2-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164633|ref|YP_343158.1|
Sequence length 154
Comment NADH dehydrogenase (ubiquinone), 24 kDa subunit [Nitrosococcus oceani ATCC 19707]
Sequence
MLSTEEIKAIDAERAHYPTAQAVGIEAMKIVQHHRGWVSDESLREIAEYLGLSVESLDGA
ATFYNLIFRRPVGKHVILICDSVSCWIMGYEQLREQLQTELKIGLGETTQDGRFTLLPSC
CLGACERAPVMVVDQDLHGDLDSEKIGEILAGYE
Download sequence
Identical sequences A0A0E2ZNE5 Q3JC18
gi|77164633|ref|YP_343158.1| 323261.Noc_1124 WP_002808774.1.20919 WP_002808774.1.77844 WP_002808774.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]