SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164811|ref|YP_343336.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164811|ref|YP_343336.1|
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.28e-66
Family Glutathione peroxidase-like 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77164811|ref|YP_343336.1|
Sequence length 212
Comment peroxidase [Nitrosococcus oceani ATCC 19707]
Sequence
MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK
KRDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVT
VRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIV
PSLTDPEVLKEKFPKGYEEIKPYLRMTPQPNK
Download sequence
Identical sequences A0A0E2Z841 Q3JBJ0
WP_002808898.1.20919 WP_002808898.1.60716 WP_002808898.1.77844 WP_002808898.1.91979 323261.Noc_1307 gi|77164811|ref|YP_343336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]