SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164816|ref|YP_343341.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|77164816|ref|YP_343341.1|
Domain Number - Region: 10-57
Classification Level Classification E-value
Superfamily TPR-like 0.00417
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77164816|ref|YP_343341.1|
Sequence length 99
Comment hypothetical protein Noc_1313 [Nitrosococcus oceani ATCC 19707]
Sequence
MEVVKRIRNPQDKARALQALAEVALKLEQPEQAIALLAELAKAATGIERSKYKAESWRLA
REMADMITSVDGRIQAFSQILMIWAEKEALPAAKKKAAS
Download sequence
Identical sequences A0A0E2Z812 Q3JBI5
gi|77164816|ref|YP_343341.1| WP_011330619.1.20919 WP_011330619.1.77844 WP_011330619.1.91979 323261.Noc_1313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]