SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164875|ref|YP_343400.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164875|ref|YP_343400.1|
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.5e-25
Family Glutathione peroxidase-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164875|ref|YP_343400.1|
Sequence length 181
Comment hypothetical protein Noc_1376 [Nitrosococcus oceani ATCC 19707]
Sequence
MRASGTLAPEWKVAQWFNTQQPLQLADLRGKVVVMHAFQMLCPGCVVHGLPQTQKIYNVF
DANEVVVVGLHTVFEHHEVMTPQALEVFIHEYRYTFPIGVDQPDGQSGLPLTMRAYGMRG
TPSLILIDHKGRLRKHSFGRDDDIQVGADIATLVSEAKAAPLAEAENASGGDGCDEDKCT
A
Download sequence
Identical sequences A0A0E2Z2Z7 Q3JBC6
WP_002808627.1.20919 WP_002808627.1.77844 WP_002808627.1.91979 323261.Noc_1376 gi|77164875|ref|YP_343400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]