SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164906|ref|YP_343431.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164906|ref|YP_343431.1|
Domain Number 1 Region: 40-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000837
Family Coronavirus S2 glycoprotein 0.01
Further Details:      
 
Weak hits

Sequence:  gi|77164906|ref|YP_343431.1|
Domain Number - Region: 58-205
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0133
Family Formin homology 2 domain (FH2 domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77164906|ref|YP_343431.1|
Sequence length 216
Comment hypothetical protein Noc_1412 [Nitrosococcus oceani ATCC 19707]
Sequence
MLNITLRAFLTSLFLLLLTGCQAAYYKTMEEFGYHKRDILADRVEEVRDTQIEAKEQFQS
ALEQFSSVVNYDGGDLEDLYEELNGEYQASQKKAEAVHDRIASVENVAGALFQEWEEELD
QYDNPSLRRSSQQQLTQTRTRYDKLIRAMKRAEAKIEPVLTTFHDQVLFLKHNLNARAIA
SLQGELSTIETDVNRLVQEMEAAIDEANEFIKTLES
Download sequence
Identical sequences A0A0E2Z251 Q3JB95
gi|77164906|ref|YP_343431.1| 323261.Noc_1412 WP_002810835.1.20919 WP_002810835.1.60716 WP_002810835.1.77844 WP_002810835.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]