SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164990|ref|YP_343515.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164990|ref|YP_343515.1|
Domain Number 1 Region: 60-169
Classification Level Classification E-value
Superfamily TPR-like 0.0000000138
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77164990|ref|YP_343515.1|
Sequence length 444
Comment hypothetical protein Noc_1499 [Nitrosococcus oceani ATCC 19707]
Sequence
MHLPQTEHSQSNMTLSGQAEAVEPRDRDYILRIARLIGWLVIGAILVWRIVVMGMAEYYA
REAPEEALAWDARHSLALRNQGERLLASAPERATQLLQESLWQNPADGRTYALLALLRER
AGNVDAARQLMERASLLAPRLWPVQLEIAAFWLRQRELERAVQSWDTALQMQRALSKEIF
PALLGIAEYPSLRPVLHPLAQSAPAWWPAFFTYAAVNTAQLETLRDLYHAAGETTATTEE
RRAFISRLQREGHWLEAYFTWLNALDEAALQGLGNLFNGHFEQPLSNGGFGWHFKRPRGV
EINTAPTYGMEGKRALRVAFLGQRVRFQHLSQPLLLPPGHYQMEGNVRLDNLETTKGLRW
VVSCLTPAQPRLAASEHFVGASLWRRFNFSFDVPKEECAAQLLRLELEGRAPADFEARGV
AWFDSLAIGRITESTLARNSAPSD
Download sequence
Identical sequences A0A0E2Z1Y5 Q3JB11
gi|77164990|ref|YP_343515.1| 323261.Noc_1499 WP_011330674.1.20919 WP_011330674.1.77844 WP_011330674.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]