SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77165100|ref|YP_343625.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77165100|ref|YP_343625.1|
Domain Number 1 Region: 28-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-22
Family RecA protein-like (ATPase-domain) 0.045
Further Details:      
 
Domain Number 2 Region: 537-634
Classification Level Classification E-value
Superfamily TPR-like 0.0000000569
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77165100|ref|YP_343625.1|
Sequence length 644
Comment ATPase [Nitrosococcus oceani ATCC 19707]
Sequence
MYTDYFGLKSHPFRLVPDPHYFFPAPFHQAVSKCLLEGLIGSLRIAVVSGPPGVGKTLLL
TRFMEQLGKNYPVIFIHNPKLGFEEFLALIQSKFNITAKDEAESVTARFSTLDSFGKHIS
QTGKRAVILVDEADNISQEAVQVFSELTRYAAAETPSFFIVLASQSNTANYQRLLVEHKN
TSKVYSLLPLLADQVGPYVDFRLRQAGYIGENPFSPEAITSLVRLSHGIPQLINQLCGAA
LLEASLTDKKLISSEIVDEVARSLWLALGNNDFSDNLSLAKGTETAFLPITEQSQTSLES
AFQTNPRERKNDDSTKETSPIIFSPSSDSPALEKQSISEKPFSLDKPLSPEQQTPQPTNT
DHNYKTPVPLPEKRQTGEKKPWIIMALGVFLALIVGLIGGAYLSALIPGKASLPAITEPT
EDTKNTANKAEGKSENSFGKGKMIASDVPPPTVMEKNRNPATQETASDSDNGMMTSSPKL
TPEKSADEISPKLGTEASVVLAQKESQQDRNKATISRTEPKRYSQRSSQEQQITLLLAQA
KQQEAAFKLTTPESDNAYESYTAILEIAPNHPEAAKGLQRIRDYYIRWGLKAEDQRDLDL
AAIYYKRALNVFPNDFAVNTALRRVEEQLQKQKEIDQPTTENDR
Download sequence
Identical sequences A0A0E2Z7A8 Q3JAQ1
gi|77165100|ref|YP_343625.1| WP_011330714.1.20919 WP_011330714.1.77844 WP_011330714.1.91979 323261.Noc_1621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]