SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77165433|ref|YP_343958.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77165433|ref|YP_343958.1|
Domain Number 1 Region: 120-201
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000159
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77165433|ref|YP_343958.1|
Sequence length 218
Comment TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
Sequence
MRSWLKLSFLFLILAAITPMVTQAQQRCGSLLPETVRYQDRQDDYLDPHPAARRHLKLVN
RAHFFFEIRQFDSYPMHIMENLNYTLVHFPNHHDALYTISRFERRQRGTLPQKITWTWRR
SAECYFVRAIRFRPKDGVVRMLYGIHLHKSGEMEQALEQYEIGLDLIPDSSELNYNLGLL
YFELKKYQLAKKYAATAYELGYPLPGLKKLLEKEGYWP
Download sequence
Identical sequences A0A0E2ZLC8 Q3J9R8
WP_002810793.1.20919 WP_002810793.1.77844 WP_002810793.1.91979 323261.Noc_1966 gi|77165433|ref|YP_343958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]