SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77165454|ref|YP_343979.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77165454|ref|YP_343979.1|
Domain Number 1 Region: 134-399
Classification Level Classification E-value
Superfamily TPR-like 1.64e-31
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 405-612
Classification Level Classification E-value
Superfamily TPR-like 1.11e-30
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 3 Region: 607-828
Classification Level Classification E-value
Superfamily TPR-like 1.77e-29
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 
Domain Number 4 Region: 812-910
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000129
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number 5 Region: 33-123
Classification Level Classification E-value
Superfamily TPR-like 0.00000000569
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77165454|ref|YP_343979.1|
Sequence length 934
Comment TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
Sequence
MPSPLISPMILICSLLLAIALLTGCSGDSNLTPEEHISRAKEYQDQGKIRATIIELKNAL
QKTPDNQEARWLLGQTYVKAGDGPSAEKELKRALSLGLASEAAAIYLTRAALLQREFQTA
IETSTDYPALPEDEQAELLALRGHAYLGLRELEKAEKSYESALSINPAAPEAGFGKARIA
AVQNRLEETRQWLEKVLQTTPSFAPAWSLLGDLERYQGNGEAAEQAYGKAIAHRFNNASD
LLNRALVRIYLKDYEGAASDLETLSKRARNHPGVTYAQGLLHFQQQQYADALTSFQKTLS
KNPEYMPAVFYAGIAYYQQGQLTQAGQLLNQFLKRFPHSDTAAKTLAMIRLREGNYTSAQ
AILEPIIAQNPNDTAALDLLGSAILGQGKPEKSAAYFQKVTAQTPESAAAYMKLGLGFMM
SGEHEQGIGALEKAIELDSQLPQADRLIILGHLRAQEFDKALAAAKRLREKQPDSPLPIN
LIGAAYLGKGEESKAQEAFRQALEIAPGDPSATHNLAMLAIKKGNIEKAHALYQEALRYH
PGHLRTLLKLSALEAQQGHPEKAKNWVEQAMEKNSKALEPRVLLARYYLEQGRPARSLAI
TREIQDLYPAHPALLLVVGTAQLENSQLRDGVKTFQKLVEVQPQSAQAHYLLAKAYATVN
NTDKLRKELEQALKLNPNHTLSKIAMTRLLMQENQPEAANKLFQELKQAYPEHPEVLAQE
GWLAMRQNRPQDAIIAFREALKRSPTSQIIVNLAHAQLQAGNQNESLATLEDWLKKHPED
MVVQYNLANLYLALKQEQKAASAFTTVVKRAPDNVVALNNLAWLLRKNDPAKALEYAERA
LELAPNAPPVMDTLGMLLLEKGEAKRSLRLLRKASDRAPENLTIRYHFALALAQNGESAQ
ARQVLDGILDAKQPFAKKKEAHALRQTLSKSLND
Download sequence
Identical sequences A0A0E2Z1E7 Q3J9P7
gi|77165454|ref|YP_343979.1| 323261.Noc_1987 WP_011330826.1.20919 WP_011330826.1.77844 WP_011330826.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]