SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77165601|ref|YP_344126.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|77165601|ref|YP_344126.1|
Domain Number - Region: 286-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0254
Family Thioltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77165601|ref|YP_344126.1|
Sequence length 636
Comment hypothetical protein Noc_2136 [Nitrosococcus oceani ATCC 19707]
Sequence
MYQKVFSLVKIGLEKQVPALGLGVFRIFLGLVILQEIVFLYYFRHLIFDTIPFIDVASPS
IYFFLILWGINTLFLTTGYHTRLAAIVNYFFWVIFTAFTPMWRDFDGGFDQFMIGSSFLL
IFLPTERAFSLDNLRVRLKFLKSELHHDPVSTVSVLSYYLPLAISLGLIYFDSAVHKLFA
EHWRNGLGAWLPLTMPYYISAIDMTWFLNQEFLQKFIGYLIIVFEFIFIFTFYLRSFRVP
LMITGISLHSGIILSLNIYPFGFGMLVYYFLMVPFSWWQGLKKTLQFKSPQLVVFYDQQC
PLCNRTRIIIEHFDIFKAINFEGLQKRAKKYPELNNISEEQLLKDIYALDQKGHLYVGID
AYLQILLKMKYPALAGIFIRIPGVYHFGKKIYRRIADQRARLTCDESCFVSSENSLQEAY
SFKRSYEYYAGTKKQRSNRITKFLVLIMLLQLNSTIHYGIFYRLNEDGAESEIGQILSPI
SNAVLFLSHAFLGITPHALYMHDHFHGYNHILALTYKNSQGQEQWLPFVNEEGRLVAPNW
GRVQSMWANVAVTPHIEQRRLYKFIKKMTAFWGKKIDLDLQDTEFIIKMKRIDVPVHWER
NLRNKNINRPWVNIGRVIWHKGLARIEIQDINLESL
Download sequence
Identical sequences A0A0E2ZKS3 Q3J9A0
323261.Noc_2136 WP_002810144.1.20919 WP_002810144.1.77844 WP_002810144.1.91979 gi|77165601|ref|YP_344126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]