SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77165888|ref|YP_344413.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77165888|ref|YP_344413.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-35
Family Thioltransferase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77165888|ref|YP_344413.1|
Sequence length 110
Comment glutaredoxin-like protein [Nitrosococcus oceani ATCC 19707]
Sequence
MDTMEQIKQAVESNSIILFMKGSPQFPQCGFSGRTVQALQACGTEFAYVDVLANPEVRAL
LPQYSNWPTFPQLYINGELVGGCDIILELFESGELQTKVQEVVPHTSEEG
Download sequence
Identical sequences A0A0E2ZK67 Q3J8G3
323261.Noc_2427 gi|77165888|ref|YP_344413.1| WP_011330961.1.20919 WP_011330961.1.60716 WP_011330961.1.77844 WP_011330961.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]