SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77166019|ref|YP_344544.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77166019|ref|YP_344544.1|
Domain Number 1 Region: 21-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.37e-55
Family NQO2-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77166019|ref|YP_344544.1|
Sequence length 175
Comment NADH dehydrogenase (ubiquinone), 24 kDa subunit [Nitrosococcus oceani ATCC 19707]
Sequence
MSVGQPERRKSRNREEENLLSSEVRQQIDYWIAKYPPERKQSAVIPALHIVQAVNGGYLT
DKLLDAVAEYLEMRPISVYEVATFYSMYELKPIGRHKISVCTNISCQLSGSDEVVAHLQK
RLGIGFGETTPDHRFTVKEAECLGACGGAPMMMAGHTYHENLTSEKIDQILEALK
Download sequence
Identical sequences A0A0E2Z006 Q3J832
gi|77166019|ref|YP_344544.1| 323261.Noc_2561 WP_004269204.1.20919 WP_004269204.1.60716 WP_004269204.1.77844 WP_004269204.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]