SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77166041|ref|YP_344566.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77166041|ref|YP_344566.1|
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.95e-38
Family Thioltransferase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77166041|ref|YP_344566.1|
Sequence length 110
Comment thioredoxin [Nitrosococcus oceani ATCC 19707]
Sequence
MTDRIIPVTVTDATFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKLKICK
LNIDENPSTPPRYGIRGIPTLMLFKNGNVEATKVGALSKSQLSAFIDSNL
Download sequence
Identical sequences A0A0E2YZB0 Q3J810
323261.Noc_2583 WP_004269169.1.20919 WP_004269169.1.60716 WP_004269169.1.77844 WP_004269169.1.91979 gi|77166041|ref|YP_344566.1| 2005420535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]