SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77166077|ref|YP_344602.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77166077|ref|YP_344602.1|
Domain Number 1 Region: 283-461
Classification Level Classification E-value
Superfamily TPR-like 8.35e-17
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  gi|77166077|ref|YP_344602.1|
Domain Number - Region: 68-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000325
Family Legume lectins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77166077|ref|YP_344602.1|
Sequence length 484
Comment peptidase M48, Ste24p [Nitrosococcus oceani ATCC 19707]
Sequence
MEKLRVQLLSTVLWSVILLTVPILSADEIELPEIGDHSGVAISPEQERSIGQAFMRRLRN
SVTIIEDPEITTYIQSLGFRLVANSDNPGQGFTFFVVQDPTINAFAAPGGYIGIHSGLVE
NSQTESELAAVLAHEIAHVTQRHLARAFEQRSRLSLPMTAALVAALILGIENPNAGLAGL
AAVQAGAAQLQINFTRSNEKEADRVGMQTLVRSGFDPFAMPAFFERLQQASRYYGTRPPE
FLSTHPVTTNRIADAMGRAQALSPQPVKEHLHFHLARAKLQVLSSDNYEQTVRQFSQALE
TGRYVNEAATRYGYALALVENGDPRKARQQILKLLEKNGDNRTYRLALARVEEAAGRFET
AFEIYENAQKLYPDDYAVVVNYASALLQGHRPQTARDLLRRQVQLGTATGRLYHLLAQAE
GDAGNRAESHRWLAEYYYYNGQPERAIKQLQLASKAANDNFYQRSKIEARLRQLQREVDA
GENT
Download sequence
Identical sequences A0A0E2ZJS3 Q3J7X4
gi|77166077|ref|YP_344602.1| WP_002814235.1.20919 WP_002814235.1.60716 WP_002814235.1.77844 WP_002814235.1.91979 323261.Noc_2619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]