SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77166217|ref|YP_344742.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77166217|ref|YP_344742.1|
Domain Number 1 Region: 542-738
Classification Level Classification E-value
Superfamily TPR-like 1.14e-29
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 2 Region: 472-556
Classification Level Classification E-value
Superfamily TPR-like 0.000000000759
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 3 Region: 28-81,219-329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000665
Family ABC transporter ATPase domain-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77166217|ref|YP_344742.1|
Sequence length 751
Comment hypothetical protein Noc_2765 [Nitrosococcus oceani ATCC 19707]
Sequence
MPPTSRYGPHPNRPAANKQFTNRDGPIKAFQAARQALAPDQHDVLTFHGVGGQGKTALGK
KFRQILEEETPRAALWGHVDLADTHLPTPDRILLELRRSLRRSGKIEFPAFDVAFAHYWQ
QAYPHLKFQDTHRDLLTDKEGVFAHALESASSYAEALPAGIGLTMIALNWVRQRMRDFDN
RYRPALRGLETFSPTEILDRLPYYLGLDLCGYQRRQRAKQLIVFLDTYDALWETFTQGAR
WEVDAWARELVASAPGVLFVVFAREKLTWDTHEPDAWRGCLHHQPPLAPLTDEDADTFLR
QIPIEEEAVRQTIIQAAEGHPFYLDLEVEHYLDLVADGATPQPEHFGQTKQAILARFLRY
RAGEEQATLKVLSVVRSFDFELLEALVRAFQTGFPPTEFFNFVRYSFVAPESGERYRLHS
LMQAHLLESLEPALQKKIHDFAFTYYDARCQPESPKDLQPAHEIALVEAFYHRDMTDPQE
AAAWINQRTTVFYEAARYSLVEPLYQRALAIREQILGPDHPDTATSLNNLAELYRAQGRY
AEAEPLYQRALAICEQVLGPDHPDTARSLNNLAGLYKAQGDYGQAEPLYRRALAICEQAL
GPDHPHTATSLNNLAGLYDSQGHYGQAKPLYQRALAIYEKTLGPDHPRTATSLNNLAALY
DTQGDYARIEPLYQRALVIHEKTCGPDHPRTATSLNNLAGLYKDQGSYAQAEPFYQRALS
ICEKNLGPDHPDTHTVRQNYQALLAAMGQQK
Download sequence
Identical sequences A0A0E2YY73 Q3J7I4
gi|77166217|ref|YP_344742.1| WP_002814158.1.20919 WP_002814158.1.77844 WP_002814158.1.91979 323261.Noc_2765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]