SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77166487|ref|YP_345012.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77166487|ref|YP_345012.1|
Domain Number 1 Region: 54-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000289
Family Glutathione peroxidase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77166487|ref|YP_345012.1|
Sequence length 204
Comment hypothetical protein Noc_3041 [Nitrosococcus oceani ATCC 19707]
Sequence
MGNRNLEAANKGIILAIFVICALPIIGAWWLLQGSEKGETFATRNYGELIIPARPLGEAT
LETLESKKLAIEELREKWTLVVLGPAECNEICRQNLYETRQIRLATGKDMHRIQRLWVTN
DLSFLDESGWLQEQHPDLIVASEEKGEEGFVNQFVLPDVPDPLMAQRVYIIDPIGNLVIS
YPPEETPEHMLKDLKRLLFVSQIG
Download sequence
Identical sequences A0A0E2YX77 Q3J6R4
WP_002812581.1.20919 WP_002812581.1.60716 WP_002812581.1.77844 WP_002812581.1.91979 323261.Noc_3041 gi|77166487|ref|YP_345012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]